PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0252369.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YA
Protein Properties Length: 157aa    MW: 17583.7 Da    PI: 10.299
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0252369.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.32.5e-3376132158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      d p+YVNaKQy++Il+RRq+Rakle+++kl +ksrkpylheSRh+hAl+R RgsgGrF
  Lj0g3v0252369.1  76 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-IKSRKPYLHESRHRHALNRVRGSGGRF 132
                      57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-3674135IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.18675135IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-2878132IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.6E-2578100IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS00686080100IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.6E-25109132IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MKSFLFMNHS ETEPSYSQVD CNNSMAHAPY PYGEPIFAGP FVAYGPQDVN QPQMLLPHML  60
GLASTRVALP LDLAQDGPIY VNAKQYHGIL RRRQSRAKLE AQNKLIKSRK PYLHESRHRH  120
ALNRVRGSGG RFLSTKQLSQ SNAEFVTGGH SGSVNFX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-2476137263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0993704e-99BT099370.1 Soybean clone JCVI-FLGm-13B20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574919.14e-89PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
SwissprotQ9SYH43e-38NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLI1MHB52e-84I1MHB5_SOYBN; Uncharacterized protein
STRINGGLYMA15G18970.15e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69493149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-39nuclear factor Y, subunit A5